KEGG   Solenopsis invicta (red fire ant): 105196980
Entry
105196980         CDS       T03916                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105196980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:soc00199]
    105196980
Enzymes [BR:soc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     105196980
Cytochrome P450 [BR:soc00199]
 Cytochrome P450, animal type
  CYP306 family
   105196980
SSDB
Motif
Pfam: p450 YbaB_DNA_bd
Other DBs
NCBI-GeneID: 105196980
NCBI-ProteinID: XP_011161459
LinkDB
Position
Unknown
AA seq 486 aa
MIALVLLGVSLVLFVYIFRKNNKTHRLPPGPCGVPLLGYLPWIDPARPHVSLTQLARKYG
PICGLRMGSVYTVLLSDPQLVRQTFAKDAFAGRAPLYLTHGIMQGYGLICAEGDLWKDQR
RFVAGCLKNFGMTKLPGAKRDKMEERILAAVNECTSKLKELAMEEIDPLETLHHCIGNMM
NDLVFGKVYEEDDKVWKWLRHLQEEGVKHIGVAGPLNFLPFLRFLPRYGKVMELLIDGQL
KTHQQYQTIIDEHRARREKTDNFLAAFDEAMSNDTNNGYFTQPQFYHLLADLFGAGTDTT
LTTFRWFLLFMATHPDEQKKIQDEMNELLGEKPPNLEDRLLLIRLEAAIAETQRLRSVVP
VGIPHGTVEDTQIGDYDVPKGTMVVPLQWAIHTDHFYWHDPLSFKPERFIAEDGSLAKPK
AFLPYQAGKRMCVGDELAKMILFLFAARILHTFVISVPSGMRIDLEGECGITLVPKSHRL
IFTLRE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgatagcccttgttctcctcggcgtatctctcgtactttttgtctatatctttcgtaaa
aataacaaaacccatcggctgccaccgggaccgtgcggtgtcccgctgcttgggtatttg
ccatggattgatccagcacgtccccatgtgtcattaactcaactggcgagaaaatatggt
ccgatctgtggcttacgaatgggctctgtatacacggtgttgttatcggatccacagctg
gtaaggcagacctttgccaaggatgcgtttgccggccgggctccactgtatttgacgcac
ggaataatgcagggatacggcctcatttgcgcagagggtgacctctggaaagatcaaaga
agatttgtagccggatgtctgaagaatttcggcatgacaaaattacctggtgccaagagg
gacaaaatggaggaaaggattctcgcggccgtgaacgagtgcacgtcgaaactaaaagaa
cttgccatggaagaaattgatcctctcgagacgcttcatcattgcattggtaacatgatg
aatgacctcgtctttggtaaagtttacgaggaggatgacaaggtgtggaaatggctaaga
cacctacaagaggaaggagtgaagcacattggagtagcaggaccgcttaactttttgccg
tttctcagatttttgccacgatatggcaaagtaatggaattactcatcgatggccaacta
aaaacgcatcaacaatatcaaacgatcatcgatgaacatcgcgctcgacgcgaaaaaacg
gataacttccttgcggcttttgacgaagcaatgagtaatgatacgaataatggatacttc
actcagccacaattttatcatctactagccgatctttttggtgcaggcaccgataccact
ctcacaacttttcgttggttcctgctcttcatggcgacacatcctgacgaacaaaaaaaa
attcaagatgaaatgaatgagttgcttggagaaaagcctcccaatttggaagacagacta
cttttaattcgattggaggcagccattgcggagacacaaagattacggagcgtagtaccg
gtcggcattcctcatggaacagtagaggacacacaaataggtgattacgatgtaccgaag
ggcaccatggttgtgcctctgcaatgggctattcatacggatcatttttactggcatgat
ccgctctcctttaaacccgagagatttattgctgaggatggaagtctggctaaaccgaaa
gcctttttaccatatcaagcaggtaaacgtatgtgcgtcggtgacgaactggccaagatg
atattatttttgttcgccgcaagaattcttcatacatttgttatctctgtaccatccggc
atgcgtatcgatttggagggtgaatgcggaataactctggttcctaaatcgcatcgcttg
atctttacattgcgggaataa

DBGET integrated database retrieval system