Solenopsis invicta (red fire ant): 105197446 Help Entry 105197446         CDS       T03916                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism soc  Solenopsis invicta (red fire ant) Pathway soc04137   Mitophagy - animal soc04140   Autophagy - animal soc04144   Endocytosis soc04145   Phagosome soc04148   Efferocytosis Brite KEGG Orthology (KO) [BR:soc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105197446    04145 Phagosome     105197446    04140 Autophagy - animal     105197446    04137 Mitophagy - animal     105197446    04148 Efferocytosis     105197446  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:soc04131]     105197446   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:soc04147]     105197446    04031 GTP-binding proteins [BR:soc04031]     105197446 Membrane trafficking [BR:soc04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     105197446 Exosome [BR:soc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105197446   Exosomal proteins of other body fluids (saliva and urine)    105197446   Exosomal proteins of colorectal cancer cells    105197446   Exosomal proteins of bladder cancer cells    105197446 GTP-binding proteins [BR:soc04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     105197446 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin AAA_16 PduV-EutP AAA_7 AAA_22 NTPase_1 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  105197446 NCBI-ProteinID:  XP_011162103 LinkDB All DBs Position 2:15345326..15350264 Genome browser AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVSAPTSFKSLDSWRDEFLIQASPRDPDNFPF VVLGNKVDLESRAVSSKRAQQWCQSKNNIPYFETSAKEAINVEQAFQTIAKNALAQESEV ELYNEFPDQIKLTNDQRSNGRGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgtcccgcaagaaagtgttgctgaaagtcattatccttggggattcaggagttggg aaaacttctttgatgaatcaatatgtcaataagaagtttagcaaccaatacaaagcaaca ataggagcagattttttgaccaaggaagttatggtggaggatagaatagtcactatgcag atttgggatactgccggacaagagaggtttcaatcgttaggagtggctttttacagaggc gcggattgttgcgtgctagtatttgatgtatctgctccgactagctttaaatctctagat tcatggagggatgaatttttaattcaagcctcgcctcgggatccagataactttccattt gtcgtgcttgggaacaaagtagatcttgaatcaagagcggtctcaagcaagagagcacaa cagtggtgtcagtcgaagaacaatattccatatttcgaaactagtgcaaaagaggctatt aatgtcgagcaagctttccaaacgatagctaagaacgctttagctcaagaaagtgaagtc gaactttacaatgaattcccggatcaaatcaaactgaccaacgaccaaagaagcaatggt agaggtgattcatgtgcttgctag

DBGET integrated database retrieval system