Solenopsis invicta (red fire ant): 105200468 Help Entry 105200468         CDS       T03916                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism soc  Solenopsis invicta (red fire ant) Pathway soc03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:soc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     105200468  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:soc03036]     105200468   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:soc04147]     105200468 Chromosome and associated proteins [BR:soc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105200468 Exosome [BR:soc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105200468 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  105200468 NCBI-ProteinID:  XP_011166335 LinkDB All DBs Position 11:6429057..6429690 Genome browser AA seq 124 aa AA seqDB search MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT EKKA NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggaaagggtggtaaagttaagggaaaggcgaagtctcgttccaacagg gcgggactgcaatttcccgtgggtcgtattcaccgattgctgaggaagggaaattacgcc gaacgcgtcggcgctggtgcgccagtttatctggctgcagtcatggagtatctcgccgct gaagtattggagttggccggcaacgccgctcgtgacaacaagaagaccaggatcatccct cgtcacttgcaactcgccatccgcaatgacgaggaattgaacaaactgttgtccggtgta accattgctcaaggtggtgttttaccgaacatccaggccgtgctgctacccaagaagacc gaaaagaaagcataa

DBGET integrated database retrieval system