Solenopsis invicta (red fire ant): 105202037 Help Entry 105202037         CDS       T03916                                  Name (RefSeq) BLOC-1-related complex subunit 7   KO K20821   BLOC-1 related complex subunit 7 Organism soc  Solenopsis invicta (red fire ant) Pathway soc04142   Lysosome biogenesis Brite KEGG Orthology (KO) [BR:soc00001]  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome biogenesis     105202037  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:soc04131]     105202037 Membrane trafficking [BR:soc04131]  Endosome - Lysosome transport   Arf GTPases and associated proteins    BLOC-one-related complex (BORC)     105202037 SSDB OrthologParalogGFIT Motif Pfam:  BORCS7 T4SS_LegC2C7 LOB Motif Other DBs NCBI-GeneID:  105202037 NCBI-ProteinID:  XP_011168691 LinkDB All DBs Position 1:25270625..25272370 Genome browser AA seq 105 aa AA seqDB search MASASSTSARSLFIESKMRLADRVQVNVNNIASLARQIQRGSRSSEILMHAARNFAQQEH GLETMESSLKKLALIGTHLEYQMDAIDKNSAMLEQVTEQVRSMQR NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggcttcagcatccagtacaagcgcacgtagcttgttcatcgagtcaaagatgagattg gcagacagagtgcaagttaatgtcaataacattgcttcgctcgccagacagatacagcga ggttcccgaagcagcgaaattctaatgcatgcagcaaggaactttgcacaacaagagcat ggattggaaacgatggaatcaagtttgaaaaagcttgcacttatcggcactcatttggaa tatcaaatggatgcaattgacaaaaattcggctatgttggaacaagttactgaacaagta cgatctatgcaacgataa

DBGET integrated database retrieval system