Sodalis praecaptivus: Sant_2477 Help Entry Sant_2477         CDS       T03004                                  Symbol acpP Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism sod  Sodalis praecaptivus Pathway sod00998   Biosynthesis of various antibiotics sod01100   Metabolic pathways sod01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sod00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sant_2477 (acpP)    00074 Mycolic acid biosynthesis     Sant_2477 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sant_2477 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  AHF77517 UniProt:  W0HYE3 LinkDB All DBs Position complement(2878200..2878436) Genome browser AA seq 78 aa AA seqDB search MSTIEESVKAIIAEQLGVKKEEVVNNASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFIQASQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaaagcgttaaggcaatcatcgctgagcaactgggcgttaagaaa gaagaagtcgtaaataatgcttctttcgttgacgacctcggcgctgactctcttgacacc gttgagctggtaatggcgctggaagaagagttcgataccgaaattccggacgaagaagct gagaaaatcactactgttcaggcagcaattgattttattcaggcaagccagcagtaa

DBGET integrated database retrieval system