Sodalis praecaptivus: Sant_3180 Help Entry Sant_3180         CDS       T03004                                  Symbol acpM Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sod  Sodalis praecaptivus Pathway sod00998   Biosynthesis of various antibiotics sod01100   Metabolic pathways sod01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sod00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sant_3180 (acpM)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sant_3180 (acpM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AHF78177 UniProt:  W0I067 LinkDB All DBs Position complement(3640131..3640370) Genome browser AA seq 79 aa AA seqDB search MSPYTIVMSSLSAVTGRPISEIKMEDELFFDLEMDSVDLIDVIIRLEDQGIIINEKDLTL KLKVSDLIQVVSSGGEIMN NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcaccctacactattgtaatgagctcattatctgctgtcaccggccggcccatatcg gaaattaaaatggaggacgaattattctttgatcttgagatggactcagttgaccttatc gatgttattataaggttggaagatcagggtataattattaatgaaaaggacttaacgctt aaattaaaggtttctgacctgattcaggtggtttcctccggcggcgagataatgaattag

DBGET integrated database retrieval system