Spinacia oleracea (spinach): 110776932 Help Entry 110776932         CDS       T05137                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism soe  Spinacia oleracea (spinach) Pathway soe03018   RNA degradation soe03040   Spliceosome Brite KEGG Orthology (KO) [BR:soe00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     110776932   09123 Folding, sorting and degradation    03018 RNA degradation     110776932  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:soe03019]     110776932    03041 Spliceosome [BR:soe03041]     110776932 Messenger RNA biogenesis [BR:soe03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      110776932   mRNA degradation factors    5'-3' decay     Lsm complex      110776932 Spliceosome [BR:soe03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     110776932  Complex C   U2 snRNP components     110776932 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX Motif Other DBs NCBI-GeneID:  110776932 NCBI-ProteinID:  XP_021837199 UniProt:  A0A9R0HWK8 LinkDB All DBs Position 5:1043302..1051526 Genome browser AA seq 93 aa AA seqDB search MLFFSYFKEIVGREVVVELKNDLAIRGTLRSVDQYLNIKLENTRVVDQEKYPHMLSVRNC FIRGSVVRYVQLPPDGVDVELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctattcttctcatatttcaaggaaattgtggggcgtgaagtggttgtggaactgaag aatgatctagccattagaggaaccctccgttctgttgatcagtacctcaatatcaagctg gagaacactagggttgttgaccaagaaaagtatcctcacatgttatcagtgaggaactgc tttataaggggttcagttgtgagatacgttcagttaccgccagatggagttgatgttgag ttgcttcatgatgccacgagaagagaagctcgaggcggctaa

DBGET integrated database retrieval system