Spinacia oleracea (spinach): 110782292 Help Entry 110782292         CDS       T05137                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism soe  Spinacia oleracea (spinach) Pathway soe03083   Polycomb repressive complex soe04120   Ubiquitin mediated proteolysis soe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:soe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110782292    04120 Ubiquitin mediated proteolysis     110782292   09126 Chromosome    03083 Polycomb repressive complex     110782292  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:soe04131]     110782292    04121 Ubiquitin system [BR:soe04121]     110782292    03036 Chromosome and associated proteins [BR:soe03036]     110782292 Membrane trafficking [BR:soe04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     110782292 Ubiquitin system [BR:soe04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      110782292    Cul7 complex      110782292 Chromosome and associated proteins [BR:soe03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      110782292   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      110782292 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  110782292 NCBI-ProteinID:  XP_021842102 UniProt:  A0A9R0I427 LinkDB All DBs Position 3:2016515..2018454 Genome browser AA seq 135 aa AA seqDB search MSPSPSPSPSTSSTNKRKIKLRSSDGKTFEVEEEVAMQSETIKSMIEVVPIPEVSGKTLS LVIDYCNKNKDDLHDDLIDWALRLFEADQAAFFDLVLAAHYLKIKSLEDLTSKTVAGVIR GKSLEEIRQTFNINK NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgtcgccgtcgccgtcgccgtcgccgtcaacgagcagtacgaataagaggaagatcaaa ctaaggagttccgatgggaagacctttgaagtagaagaagaagtagcaatgcaatcagaa accataaaatccatgatagaagtcgttccgattcccgaggttagtggtaagacattgtct ttggtcattgactactgcaacaagaacaaagatgatcttcatgatgatctcatagattgg gcccttcgtctctttgaagctgatcaagctgctttctttgatctcgttctggccgcgcat tatttgaagatcaaaagcttggaggatttgactagcaagactgtggcaggcgttataaga ggaaagtccctagaagaaatcaggcaaacattcaacataaataagtaa

DBGET integrated database retrieval system