Spinacia oleracea (spinach): 110783369 Help Entry 110783369         CDS       T05137                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism soe  Spinacia oleracea (spinach) Brite KEGG Orthology (KO) [BR:soe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:soe03041]     110783369   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:soe04052]     110783369 Spliceosome [BR:soe03041]  Complex B   Other components    Complex B specific factors     110783369 Cytokines and neuropeptides [BR:soe04052]  Neuropeptides   Unclassified    110783369 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Crinkler PI3K_rbd Tautomerase Motif Other DBs NCBI-GeneID:  110783369 NCBI-ProteinID:  XP_021843397 UniProt:  A0A9R0I6E7 LinkDB All DBs Position 4:3457894..3461685 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTVGDLKKLVAAQTGTRSEKIRIQKWYTIYKDHITLRDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtgttgaacgacagattggggaagaaagtgcgcgtaaagtgcaacgaa gatgacaccgttggagacttgaagaagcttgttgctgctcagactggtactcgctctgaa aagatacgaattcagaagtggtacacaatttacaaggatcatatcacgctcagggattac gagattcatgatggcatgggtctcgagctctactacaattga

DBGET integrated database retrieval system