Spinacia oleracea (spinach): 110799043 Help Entry 110799043         CDS       T05137                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism soe  Spinacia oleracea (spinach) Pathway soe04145   Phagosome soe04148   Efferocytosis soe04620   Toll-like receptor signaling pathway soe05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:soe00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110799043    04148 Efferocytosis     110799043  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110799043  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110799043  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:soe04131]     110799043   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:soe04147]     110799043    04031 GTP-binding proteins [BR:soe04031]     110799043 Membrane trafficking [BR:soe04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110799043  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110799043   Macropinocytosis    Ras GTPases     110799043  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110799043 Exosome [BR:soe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110799043   Exosomal proteins of other body fluids (saliva and urine)    110799043   Exosomal proteins of colorectal cancer cells    110799043   Exosomal proteins of bladder cancer cells    110799043 GTP-binding proteins [BR:soe04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110799043 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  110799043 NCBI-ProteinID:  XP_021859934 UniProt:  A0A9R0J2C5 LinkDB All DBs Position 6:complement(73293872..73297166) Genome browser AA seq 196 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPISTQQGEELKRVIGAPYYIECSSKTQQNVKAVFDAAIKVVLQP PKTKKKKKKAKGCYIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagcgcatccaggttcatcaaatgtgttacagtgggtgatggtgctgtgggtaaaact tgtatgcttatttcttacaccagcaacacttttccaacggactatgtacctacagttttt gataacttcagtgctaatgttgttgttgatgggaacacagtcaacctagggttatgggat actgccggtcaagaagactacaatagattgagacctctgagctatcgtggagctgatgta tttattttagcgttctcattgattagcaaggctagttatgaaaatgttgccaaaaaatgg attcctgagctgaggcactatgcacctggtgttccaataattctcgttggaacaaaacta gatcttcgggatgataagcaatttttcgtagatcatcctggtgcagttcccatttcaact caacaaggagaggagctgaaaagagtcattggcgccccttactacattgagtgtagttca aaaactcaacagaatgtgaaggcagtttttgatgcggccattaaggttgtccttcagccg ccaaagaccaagaaaaagaaaaagaaggcgaaaggatgttatattttgtga

DBGET integrated database retrieval system