Serratia odorifera: NCTC11214_00612 Help Entry NCTC11214_00612   CDS       T06612                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sof  Serratia odorifera Pathway sof01100   Metabolic pathways sof01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sof00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC11214_00612 (acpP_1)    00074 Mycolic acid biosynthesis     NCTC11214_00612 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC11214_00612 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  VDZ52264 UniProt:  A0A3S4HFH1 LinkDB All DBs Position 1:complement(542173..542424) Genome browser AA seq 83 aa AA seqDB search MDKQQIFEQIQTLLVKLFELDAEDITLESRLYEELELDSIDAVDLVVHLQKITGKKIKPE MFKSVRTVQDVVDAIDELQKSAG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggataagcaacagattttcgaacagattcaaacgctgctggtcaagctgttcgagctt gatgccgaggatatcacgctcgaatcccgcctgtatgaagaactggaactggacagcatc gacgccgtcgatctggtggttcacctgcaaaaaatcaccggcaagaaaatcaagcccgag atgttcaaatcggtgcgcacggtacaagacgtggttgatgcgattgacgaattacagaag tctgctggctga

DBGET integrated database retrieval system