Serratia odorifera: NCTC11214_00613 Help Entry NCTC11214_00613   CDS       T06612                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sof  Serratia odorifera Pathway sof01100   Metabolic pathways sof01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sof00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC11214_00613    00074 Mycolic acid biosynthesis     NCTC11214_00613   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC11214_00613 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  VDZ52267 UniProt:  A0A3S4FI66 LinkDB All DBs Position 1:complement(542434..542694) Genome browser AA seq 86 aa AA seqDB search MNVLSNEIKQLIIDTLNLEGMTPDEIETQAPLFGEGLGLDSIDALELGLALKNRYGVVLS AESEDMRQHFYSVETLAKFVSAQRSK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaatgtattgagcaacgaaatcaagcaattgattatagacacgctcaatcttgaaggt atgacaccggatgagattgaaacacaggcgccattatttggcgaagggttgggtctggat tcgattgatgcgctcgaattgggactggccctcaaaaatcgttacggtgtggtactgtcg gccgaaagcgaagatatgcgccaacatttttattccgtggaaacgctggcaaagtttgtt tctgcacagcgtagcaaataa

DBGET integrated database retrieval system