Serratia odorifera: NCTC11214_00787 Help Entry NCTC11214_00787   CDS       T06612                                  Symbol leuB_2 Name (GenBank) 3-isopropylmalate dehydrogenase   KO K00052   3-isopropylmalate dehydrogenase [EC:1.1.1.85] Organism sof  Serratia odorifera Pathway sof00290   Valine, leucine and isoleucine biosynthesis sof00660   C5-Branched dibasic acid metabolism sof01100   Metabolic pathways sof01110   Biosynthesis of secondary metabolites sof01210   2-Oxocarboxylic acid metabolism sof01230   Biosynthesis of amino acids Module sof_M00432   Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate Brite KEGG Orthology (KO) [BR:sof00001]  09100 Metabolism   09101 Carbohydrate metabolism    00660 C5-Branched dibasic acid metabolism     NCTC11214_00787 (leuB_2)   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     NCTC11214_00787 (leuB_2) Enzymes [BR:sof01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.85  3-isopropylmalate dehydrogenase      NCTC11214_00787 (leuB_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Iso_dh Motif Other DBs NCBI-ProteinID:  VDZ52629 UniProt:  A0A447KM63 LinkDB All DBs Position 1:700975..701292 Genome browser AA seq 105 aa AA seqDB search MITGSMGMLPSASLNEDGFGLYEPAGGSAPDIAGKGIANPIAQILSATLMLRYSLGADEA ADAIERAINQALEQGYRTADLAGDGKAISTDEMGDIIARFVAQGA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgattaccggctcgatgggcatgctgccttctgccagcctgaacgaggacggtttcggc ctgtatgagccggcaggcggttctgcgccggacatcgccggtaagggcattgccaacccg atcgcccagatcctgtccgccaccctgatgctgcgttacagcctgggagccgacgaggcc gccgacgcgatcgaacgtgccatcaaccaggcgttggaacaggggtaccgcactgccgat ctggccggtgacggcaaggcaatcagcaccgatgaaatgggcgacatcatcgctcgcttt gtggcacagggggcttaa

DBGET integrated database retrieval system