Serratia odorifera: NCTC11214_05126 Help Entry NCTC11214_05126   CDS       T06612                                  Symbol dinI_3 Name (GenBank) DNA-damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism sof  Serratia odorifera Brite KEGG Orthology (KO) [BR:sof00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sof03400]     NCTC11214_05126 (dinI_3) DNA repair and recombination proteins [BR:sof03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     NCTC11214_05126 (dinI_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI ZT_dimer Motif Other DBs NCBI-ProteinID:  VDZ64733 UniProt:  A0A447L130 LinkDB All DBs Position 1:4707898..4708140 Genome browser AA seq 80 aa AA seqDB search MRIFVEVRLDKKKQLPTGAASALAVELNKRLQRKFSDIEATVRMAGMDGLSVRNGTPADR EAIEEVLQETWESADDWFEI NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcggatttttgttgaggtgcgtttagacaagaaaaaacaactgcccactggcgcagcc tctgctctggccgttgagttgaataaacggctgcagcgtaaattttcagatatcgaggca accgttcgcatggctggtatggacgggctttcagtgcgcaacggtacgccagcggacaga gaggcgatcgaggaagtactgcaggaaacgtgggaaagtgcggacgactggtttgaaata tga

DBGET integrated database retrieval system