Shewanella oncorhynchi: RA178_13855 Help Entry RA178_13855       CDS       T09381                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sog  Shewanella oncorhynchi Pathway sog01100   Metabolic pathways sog01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sog00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RA178_13855 (acpP)    00074 Mycolic acid biosynthesis     RA178_13855 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RA178_13855 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB HLH Motif Other DBs NCBI-ProteinID:  WMB71509 UniProt:  A0AA50KAU2 LinkDB All DBs Position complement(3067034..3067267) Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIVEQLGVKEEDVKPAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVSKNQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgtgtaaagaaaatcattgtagagcaactgggcgttaaagaa gaagacgttaagccagcggcatctttcgttgacgatctgggtgcagattctctggacact gttgagttggttatggctctggaagaagagtttgataccgagatccctgatgaagaagct gaaaagatcactactgttcaagcagcgatcgactacgtttctaagaatcagtaa

DBGET integrated database retrieval system