KEGG   Streptococcus cristatus: I872_03030
Entry
I872_03030        CDS       T02649                                 
Symbol
atpC
Name
(GenBank) F0F1 ATP synthase subunit epsilon
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
soi  Streptococcus cristatus
Pathway
soi00190  Oxidative phosphorylation
soi01100  Metabolic pathways
Module
soi_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:soi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I872_03030 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:soi00194]
    I872_03030 (atpC)
Photosynthesis proteins [BR:soi00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   I872_03030 (atpC)
SSDB
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE APC_u15
Other DBs
NCBI-ProteinID: AGK70711
UniProt: A0ABN4B8D6
LinkDB
Position
626091..626510
AA seq 139 aa
MAQMTVQIVTPDGLIYDHRAAFVSVKTIDGELGILPRHINTIAVLEVDQVKVRRIDDDKH
IDWIAVNGGIIEIADNVITIIADSAERERDIDISRAERAKLRAEKEIEEAQDKHLIDQER
RAKIALQRAINRINVGTRM
NT seq 420 nt   +upstreamnt  +downstreamnt
atggctcaaatgacagtacaaatcgttacaccggatggtctgatttatgaccaccgtgct
gcatttgtttccgtaaaaacgattgacggagaactggggattttgcctcgccatatcaat
acaattgctgttttggaagtagatcaggtcaaggtacgcagaattgatgatgacaagcat
attgactggattgcagtcaacggtggcatcatagaaattgctgataatgtgattaccatt
atcgctgactcagcagagcgtgagcgtgatattgatatcagccgtgccgagcgggccaaa
ctgcgggctgagaaagaaatcgaagaagctcaagacaagcatttgattgaccaagagcgc
cgtgctaaaatcgccctccagcgtgccatcaaccgtattaacgttggaacaagaatgtaa

DBGET integrated database retrieval system