KEGG   Streptococcus cristatus: I872_07485
Entry
I872_07485        CDS       T02649                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
soi  Streptococcus cristatus
Pathway
soi00770  Pantothenate and CoA biosynthesis
soi01100  Metabolic pathways
soi01240  Biosynthesis of cofactors
Module
soi_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:soi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    I872_07485 (coaD)
Enzymes [BR:soi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     I872_07485 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig Pantoate_ligase
Other DBs
NCBI-ProteinID: AGK71579
UniProt: A0ABM5NLE9
LinkDB
Position
complement(1516178..1516663)
AA seq 161 aa
MSDKIGLFTGSFDPITNGHVDLIERASRLFDRLYVGIFYNPHKEGFFSIHAKKRMVLAAL
AHLENVEVITSHDELAVDVAKRLGVTALVRGLRNGQDLDYEASLHFFNKDLEPDLETVFL
LSQPAYRYISSSAMRELIAFQQNLSAYVPASVIEELEKKDE
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcagataaaattggactctttacagggtcatttgatcccattaccaatggacatgtg
gatttgattgagcgtgccagtcggctgtttgatcgcttgtatgtgggcattttctacaat
cctcacaaagaaggattttttagcatccatgcgaaaaaaagaatggttctagcggctttg
gcgcatttggaaaatgtggaagtcatcacttcccatgatgaattggcggtcgatgtggca
aaaagactgggtgtgactgcccttgtccgcggcctacgcaatggtcaggacttggactat
gaagctagcctgcattttttcaataaggacttagagcctgacttggagaccgtttttttg
ctgagtcagccggcctaccgatacatcagttcttcagcgatgcgggaattgattgctttc
cagcagaatctttctgcctatgtaccagcgagtgtgattgaggagttagagaaaaaagat
gaataa

DBGET integrated database retrieval system