Solimonas sp. K1W22B-7: D0B54_02785 Help Entry D0B54_02785       CDS       T05591                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism sok  Solimonas sp. K1W22B-7 Brite KEGG Orthology (KO) [BR:sok00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sok03032]     D0B54_02785    03036 Chromosome and associated proteins [BR:sok03036]     D0B54_02785    03400 DNA repair and recombination proteins [BR:sok03400]     D0B54_02785 DNA replication proteins [BR:sok03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     D0B54_02785 Chromosome and associated proteins [BR:sok03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     D0B54_02785 DNA repair and recombination proteins [BR:sok03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       D0B54_02785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-HIG HU-CCDC81_euk_2 VWA_3 HU-CCDC81_euk_1 Pentapeptide Motif Other DBs NCBI-ProteinID:  AXQ27658 UniProt:  A0A346MWH1 LinkDB All DBs Position 566783..567055 Genome browser AA seq 90 aa AA seqDB search MNKTDLINAVADKADLSKADAGRAIDSLFEVVAKALKKRDKVSLVGFGTFQVRERKARVG RNPKTGAPLKIKASKTPSFKAGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagaccgatctgatcaacgcggttgccgacaaggccgacctgtccaaggccgat gccggtcgcgcgatcgattcactgtttgaggtggtggccaaggcgctgaagaagcgcgac aaggtttcgctggtgggtttcggcaccttccaggtgcgcgagcgcaaggcccgcgtcggc cgcaaccccaagaccggagcccccctgaagatcaaggccagcaaaactccgagcttcaag gctggtaaagcgctcaaggacgctgtaaagtag

DBGET integrated database retrieval system