Solimonas sp. K1W22B-7: D0B54_05630
Help
Entry
D0B54_05630 CDS
T05591
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
sok
Solimonas sp. K1W22B-7
Pathway
sok00190
Oxidative phosphorylation
sok01100
Metabolic pathways
sok02020
Two-component system
Module
sok_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
sok00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
D0B54_05630 (petA)
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
D0B54_05630 (petA)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
D0B54_05630 (petA)
Enzymes [BR:
sok01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
D0B54_05630 (petA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UCR_Fe-S_N
Rieske
Oxidored_q6
Motif
Other DBs
NCBI-ProteinID:
AXQ28188
LinkDB
All DBs
Position
complement(1204594..1205187)
Genome browser
AA seq
197 aa
AA seq
DB search
MSNQGVDPDRRRFLTLTTTVVGGVGVAAAAWPFLASLKPSDRAKALGAPVSIDITHLEAG
QKLTVAWRGKPVWVIKRTPEMVASLAKVSGNLRDPGSDEQQQPEYAKNEARAIKPEILVM
VGSCTHLGCSPTFRPDHPAKDIDSAWEGGFYCPCHGSKFDLAGRVYKGVPAPLNLAVPPH
RYVDGNTILVGEDQGAA
NT seq
594 nt
NT seq
+upstream
nt +downstream
nt
atgagtaatcaaggcgtggatccggaccgccgccggttcctgaccctgaccacgacggtc
gtgggtggcgtaggtgtagcggccgcggcctggcccttcctggcgtccctcaagccgagc
gaccgcgccaaggcccttggcgccccggtcagcatcgacatcacccacctcgaggccggc
cagaagctgacggtcgcctggcgcggcaagccggtctgggtgatcaagcgcaccccggag
atggtcgccagcctggccaaggtctccggcaacctgcgcgacccgggttccgatgaacag
cagcagccggagtacgccaagaacgaggcccgcgcgatcaagccggaaatcctcgtcatg
gtcggctcctgcacccacctgggctgctcgccgactttccgtccggaccaccctgcaaaa
gacatcgactcggcctgggaaggcggcttctactgcccctgccacggctccaagttcgac
cttgccggccgcgtctacaagggcgtccccgccccgctgaacctggccgtgccgccgcac
cgctatgtggacggcaacaccattctcgtcggcgaagaccagggagctgcgtaa
DBGET
integrated database retrieval system