KEGG   Solimonas sp. K1W22B-7: D0B54_09570
Entry
D0B54_09570       CDS       T05591                                 
Name
(GenBank) putative 2-aminoethylphosphonate ABC transporter ATP-binding protein
  KO
K02010  iron(III) transport system ATP-binding protein [EC:7.2.2.7]
Organism
sok  Solimonas sp. K1W22B-7
Pathway
sok02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sok00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    D0B54_09570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sok02000]
    D0B54_09570
Enzymes [BR:sok01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.7  ABC-type Fe3+ transporter
     D0B54_09570
Transporters [BR:sok02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    D0B54_09570
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 ABC_ATPase OB_MalK AAA SMC_N AAA_28 AAA_23 RsgA_GTPase AAA_16 NACHT nSTAND1 AAA_22 AAA_5 Mg_chelatase AAA_25 AAA_29 ATPase_2 TsaE PduV-EutP MIT_C Rad17 ORC-CDC6-like NB-ARC AAA_14
Other DBs
NCBI-ProteinID: AXQ28919
LinkDB
Position
2079776..2080828
AA seq 350 aa
MSETILNIRGLHKRYGQATALRDIDLDVRAGEFVCFLGPSGCGKTTLLRAIAGLDPQTSG
TIQLYQQDISRRPPEQRGFGIVFQSYALFPNLSVLDNVTYGLVGKGLPRARREARGRELL
SLVGLAGFDAKYPGQCSGGQQQRIALARALAPEPSLLLLDEPLSALDAKVRVHLRSEIKA
LQEKLGVTTIMVTHDQEEALTMADRIVVMDHGAIEQVGTPQDIYERPASRFVAEFVGAMN
FLPARVLRPDALLLGERELRLPRPCLHPVGEKVLAAIRPEHLRLDGQGLPATLTWREFLG
SHTRLWLQLDDGTEAQLLLAPQACDELPADGSRVALGFDPRHLHVYKAKA
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtccgaaaccatcctcaacatccgcggcctgcacaagcgctacggccaggccacggcg
ctgcgcgacatcgacctcgacgtgcgcgcgggcgagttcgtctgcttcctgggtccctcc
ggctgcggcaagaccacgctgctgcgcgcgatcgccgggctcgatccgcagacctcggga
acgatccagctgtaccagcaggacatctcgcggcggccgccggagcagcgcggtttcggc
atcgtgttccagtcctacgccttgtttcccaacctgagcgtgctggacaacgtcacctac
ggcctggtcggcaagggactgccccgcgcccggcgggaggcccgcgggcgcgagctgctg
tccctggtcggcctggccggtttcgatgccaagtatcccggccagtgctccggcggccag
cagcagcgcatcgcgctggcgcgggcgctggcgccggagccgagcctgctgctgctggac
gagcccctgtcggcgctggacgcgaaggtgcgcgtgcacctgcgcagcgagatcaaggcg
ctgcaggaaaagctcggcgtcaccacgatcatggtcacgcacgaccaggaggaggcgctg
accatggccgaccgcatcgtggtgatggaccatggcgcgatcgagcaggtcggcacgccg
caggacatctacgagcggccggccagccgcttcgtcgccgaattcgtcggtgcgatgaac
ttcctgccggcgcgggtattgcggcccgacgcgctgctgctcggcgagcgcgagctgcgg
ttgccgcggccttgcctgcacccggttggcgaaaaggtgcttgccgccatccgcccggag
cacctgcgcctggacgggcaggggctgccggcgacgctgacctggcgcgagttcctcggc
agccacacgcgcctgtggctgcagctcgacgacggcaccgaagcgcagctgctgcttgcg
ccccaggcctgcgacgagttgccggcggatggcagccgggtcgcactcgggttcgatccg
cgtcacctgcacgtgtacaaggccaaggcatga

DBGET integrated database retrieval system