Solimonas sp. K1W22B-7: D0B54_09990 Help Entry D0B54_09990       CDS       T05591                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism sok  Solimonas sp. K1W22B-7 Brite KEGG Orthology (KO) [BR:sok00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sok03036]     D0B54_09990 Chromosome and associated proteins [BR:sok03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     D0B54_09990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC Motif Other DBs NCBI-ProteinID:  AXQ28996 UniProt:  A0A346N0A9 LinkDB All DBs Position 2177987..2178265 Genome browser AA seq 92 aa AA seqDB search MSNRVAIAVLALMLTGLQWRLWVADGGVAHTHRLKAQVQAQQEENAKLMARNAARDAEVR DLGSGTAAIEARARTTLGMIKANETFYLVVAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccgcgtcgccattgcagttctcgccctgatgttgacggggctgcagtggcgg ctgtgggttgccgacgggggggtagcccatacccaccggctcaaggcgcaggtccaggcc cagcaggaagagaacgccaagctgatggcccgcaacgccgcccgcgatgccgaagtgcgc gacctgggcagcggcaccgccgccatcgaggcccgcgcccgcaccaccctgggcatgatc aaggcgaacgagaccttctatctcgtggtggcgcagtag

DBGET integrated database retrieval system