Solimonas sp. K1W22B-7: D0B54_12390 Help Entry D0B54_12390       CDS       T05591                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sok  Solimonas sp. K1W22B-7 Pathway sok01100   Metabolic pathways sok01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sok00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D0B54_12390    00074 Mycolic acid biosynthesis     D0B54_12390   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D0B54_12390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5798 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AXQ29437 UniProt:  A0A346N1K0 LinkDB All DBs Position complement(2726507..2726749) Genome browser AA seq 80 aa AA seqDB search MSTLEEKVKKIIAEQLSVSEDQITPTASFVEDLGADSLDTVELVMALEEEFEIDIPDEEA EKIVTFSDVLNYIKAHTQQG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcacgttggaagagaaagtaaagaagatcatcgctgagcagctgtccgtcagcgaa gatcagatcacccccaccgcctcgttcgtcgaggatctgggtgcggactccctggatacc gtcgagctggtgatggcgctggaagaagagttcgaaatcgacatcccggatgaggaagcc gagaaaatcgtgaccttctcggacgttctgaactacatcaaggcccacacccagcagggt tga

DBGET integrated database retrieval system