Saccharolobus solfataricus 98/2: Ssol_1149 Help Entry Ssol_1149         CDS       T02126                                  Name (GenBank) Ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism sol  Saccharolobus solfataricus 98/2 Pathway sol03010   Ribosome Brite KEGG Orthology (KO) [BR:sol00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Ssol_1149   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Ssol_1149  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sol03011]     Ssol_1149    04121 Ubiquitin system [BR:sol04121]     Ssol_1149 Ribosome [BR:sol03011]  Ribosomal proteins   Eukaryotes    Large subunit     Ssol_1149   Archaea     Ssol_1149 Ubiquitin system [BR:sol04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Ssol_1149 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e zf-ChsH2 HypA DZR Zn_Ribbon_1 Zn_ribbon_HMPTM zf-tcix Zn_ribbon_RanBP Zn_ribbon_LapB DHHC Motif Other DBs NCBI-ProteinID:  ACX91387 UniProt:  D0KRL8 LinkDB All DBs Position complement(1070477..1070647) Genome browser AA seq 56 aa AA seqDB search MPLTDPAKLQIVQQRVFLKKVCRKCGALNPIRATKCRRCHSTNLRLKKKELPTKKG NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgccgctaaccgatcccgctaaattgcaaatagtgcagcaaagggtatttttgaaaaaa gtctgcagaaaatgtggggctcttaatcctataagagcaaccaagtgtagacgatgccat agtacaaacttaagattgaagaagaaggaactaccaactaagaaaggctaa

DBGET integrated database retrieval system