Saccharolobus solfataricus 98/2: Ssol_1409 Help Entry Ssol_1409         CDS       T02126                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism sol  Saccharolobus solfataricus 98/2 Pathway sol03010   Ribosome Brite KEGG Orthology (KO) [BR:sol00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Ssol_1409   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Ssol_1409  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sol03011]     Ssol_1409    04121 Ubiquitin system [BR:sol04121]     Ssol_1409   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sol04147]     Ssol_1409 Ribosome [BR:sol03011]  Ribosomal proteins   Eukaryotes    Small subunit     Ssol_1409   Archaea     Ssol_1409 Ubiquitin system [BR:sol04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Ssol_1409 Exosome [BR:sol04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Ssol_1409   Exosomal proteins of colorectal cancer cells    Ssol_1409 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_SprT YPEH2ZP Zn_ribbon_PriA Zn_ribbon_Nudix Zn_ribbon_RPB9 UPF0179 Zn_Ribbon_1 YhfH DUF7838 FlhC DUF5795 Zn_ribbon_3 DUF1451 Zn_ribbon_13 DUF6758 Zn_ribbon_ACC Motif Other DBs NCBI-ProteinID:  ACX91643 UniProt:  D0KSC4 LinkDB All DBs Position complement(1307270..1307461) Genome browser AA seq 63 aa AA seqDB search MAKEQKVKAIVRTYYVIEGNKVKLKNKKCPRCGSIMAHHLKPNERWSCGKCGYTEFIGAS KKR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt gtggccaaggagcaaaaggttaaagcaatagtaaggacttattacgtgatcgaagggaat aaggtaaagctgaaaaataagaaatgccctagatgtggaagtataatggctcatcaccta aaaccaaatgaaagatggtcttgtggaaagtgtggttacactgagtttataggcgcttct aagaaaagataa

DBGET integrated database retrieval system