Shewanella oneidensis: SO_0703 Help Entry SO_0703           CDS       T00099                                  Symbol groES Name (GenBank) 10 kDa chaperonin GroES   KO K04078   chaperonin GroES Organism son  Shewanella oneidensis Brite KEGG Orthology (KO) [BR:son00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:son03110]     SO_0703 (groES)    03029 Mitochondrial biogenesis [BR:son03029]     SO_0703 (groES) Chaperones and folding catalysts [BR:son03110]  Heat shock proteins   HSP10    SO_0703 (groES) Mitochondrial biogenesis [BR:son03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     SO_0703 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AAN53781 UniProt:  Q8CX49 LinkDB All DBs Position 720670..720960 Genome browser AA seq 96 aa AA seqDB search MNIRPLHDRVIVKRLEVESTSAGGIVLTGSAAEKSTRGEVLAVGNGRILENGTVRPLDVK VGDVVIFNEGYGVKKEKIDGQEVLILSEADLMAIVG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaatattcgtccattacatgaccgcgtaatcgttaagcgtctagaagttgaatcaact tctgcgggtggcatcgtattaaccggtagcgccgccgaaaaatcgactcgcggggaagtg cttgcagtaggtaacggccgtattttagaaaacggcactgtaagacctctggatgtgaaa gtgggtgatgtagtgatcttcaatgaaggttacggcgttaagaaagaaaaaatcgacggt caagaagtcttgatcctgtcagaagctgacctgatggccatcgtaggttaa

DBGET integrated database retrieval system