Shewanella oneidensis: SO_4368 Help Entry SO_4368           CDS       T00099                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism son  Shewanella oneidensis Pathway son01100   Metabolic pathways son01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:son00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SO_4368    00074 Mycolic acid biosynthesis     SO_4368   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SO_4368 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAN57336 UniProt:  Q8E9B6 LinkDB All DBs Position 4563337..4563591 Genome browser AA seq 84 aa AA seqDB search MTLHNEIKQLIIDCLDLEDVSIDDIETDAPLFGDGLGLDSIDALELGLAIKKKFDVKIEA NSDSTKAHFYSVASLAKFIESQRP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgactttacacaatgaaattaaacagttaattatcgactgcctcgacctcgaagatgtc agtattgatgatattgaaaccgatgcgcccctatttggtgacggactcggactcgattct atcgacgccctcgagttagggttagccatcaaaaaaaaatttgatgtcaaaatcgaagcc aactcggatagcactaaggcacatttttacagtgtggccagccttgctaaatttatcgaa tcacagcgcccatag

DBGET integrated database retrieval system