Shewanella oneidensis: SO_4369 Help Entry SO_4369           CDS       T00099                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism son  Shewanella oneidensis Pathway son01100   Metabolic pathways son01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:son00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SO_4369    00074 Mycolic acid biosynthesis     SO_4369   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SO_4369 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AAN57337 UniProt:  Q8E9B5 LinkDB All DBs Position 4563601..4563849 Genome browser AA seq 82 aa AA seqDB search MQNREQILAMLTTILVDEFEIDADAITPDANLYEELDLDSIDAVDLVIKLQQLTGKKIQP DEFKSVRTVNDVVNAIEGLVKD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaaccgtgaacaaatcctcgctatgctgaccacgattttagtggatgagtttgaa atcgatgccgacgcgattacccccgacgccaatctttacgaagaattagatttagacagc attgatgccgtcgatctggtgataaaactgcagcaactgacaggcaaaaaaattcagccc gatgaatttaaatcagttcgcaccgtcaatgatgtggtcaacgccattgaaggcctagtg aaagactaa

DBGET integrated database retrieval system