Sorangium sp. So ce836: NQZ70_01970 Help Entry NQZ70_01970       CDS       T11263                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sorg  Sorangium sp. So ce836 Pathway sorg00998   Biosynthesis of various antibiotics sorg01100   Metabolic pathways sorg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sorg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NQZ70_01970 (acpP_2)    00074 Mycolic acid biosynthesis     NQZ70_01970 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NQZ70_01970 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  WCQ89283 LinkDB All DBs Position 2706761..2707087 Genome browser AA seq 108 aa AA seqDB search MKKSEAALEKQPQAASGGDPEIAREVRTIIAERCGMSVDAVTPDLSLENGLGVDSLALIE VNVALEERFQIVAPDFAAPDQAQISTVGDVIAFVEAQLAARGGRGGAS NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgaagaagagcgaagcggcgctggagaagcagccgcaggcggcgagcgggggagatccg gagatcgcccgcgaggtccgcaccatcattgcagagcgatgtgggatgagcgtcgatgcc gtgactcccgatctgtcgctcgagaacggcctcggcgtggattcgctggcgctcatcgag gtcaacgtcgcattggaggagcgattccagatcgtggcgcccgatttcgcggcgccggat caggcgcagatcagcacggtcggcgacgtgatcgccttcgtcgaggcgcagctcgcggcg cggggcggccggggaggggcgtcgtga

DBGET integrated database retrieval system