Sorangium sp. So ce836: NQZ70_04155 Help Entry NQZ70_04155       CDS       T11263                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism sorg  Sorangium sp. So ce836 Pathway sorg00261   Monobactam biosynthesis sorg01100   Metabolic pathways sorg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sorg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NQZ70_04155  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sorg01008]     NQZ70_04155 Polyketide biosynthesis proteins [BR:sorg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NQZ70_04155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WCQ91436 LinkDB All DBs Position 5706296..5706511 Genome browser AA seq 71 aa AA seqDB search MSQGERQDVATYRVVVDHEKQYTVCPVERAIPRGWREAGKQGSVMECLAYIDQAWERLRA PAEGCAPVDVA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagccagggagagcgacaggacgtagcgacctatcgagtcgtcgtcgatcacgagaag cagtataccgtctgccctgtcgagcgcgcgatcccgcgcgggtggcgggaggccggcaag caggggtccgtcatggagtgcctcgcttatatcgatcaggcatgggagcgcctgcgcgcc ccggcggagggatgcgccccagtcgatgtcgcgtga

DBGET integrated database retrieval system