Sorangium sp. So ce836: NQZ70_05969 Help Entry NQZ70_05969       CDS       T11263                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sorg  Sorangium sp. So ce836 Pathway sorg00998   Biosynthesis of various antibiotics sorg01100   Metabolic pathways sorg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sorg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NQZ70_05969    00074 Mycolic acid biosynthesis     NQZ70_05969   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NQZ70_05969 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WCQ93221 LinkDB All DBs Position 8212269..8212559 Genome browser AA seq 96 aa AA seqDB search MKVRTKADVWRCVVESVEELMADLDQDPGDLTPEITLMGDLGIKSMDVIHLVLLLKDRIG RSLTYKDVFGDGQEPPADLSLAQLSDLVCRGLRITA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaaggtacgtacgaaggcggacgtgtggcgttgtgtcgtcgagtcggtcgaggagctc atggcagacctcgaccaggatcccggcgacctcacccccgagatcacgttgatgggcgat ctggggatcaagtcgatggacgtgatccacctcgtgctcctgctcaaggatcgcatcggc cggtcgctcacctacaaggatgtcttcggagacgggcaggagcctccggcggatctgtcg ctcgcgcagctctcggacctggtctgcagggggctgcgaatcacagcgtag

DBGET integrated database retrieval system