Sorangium sp. So ce836: NQZ70_08426 Help Entry NQZ70_08426       CDS       T11263                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sorg  Sorangium sp. So ce836 Pathway sorg00998   Biosynthesis of various antibiotics sorg01100   Metabolic pathways sorg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sorg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NQZ70_08426    00074 Mycolic acid biosynthesis     NQZ70_08426   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NQZ70_08426 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 PSMD12-CSN4_N Motif Other DBs NCBI-ProteinID:  WCQ95649 LinkDB All DBs Position 11432344..11432610 Genome browser AA seq 88 aa AA seqDB search MTWTRETLRAEIIQLLEGHTAGEVKIEESSHLVADLSLDSLGVMEIVADMEDKFDLSIPD DMLREVDTVADVVKAIELRLKNEGRLSG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgacgtggacacgggagacgttgcgggcagagatcatccagctcctggagggacacacg gccggcgaggtgaagatcgaggagtcgagccatctcgtcgccgatctcagcctcgactcg ctcggggtgatggagatcgtcgcggacatggaggataagttcgacctctcgatccccgac gacatgttgcgcgaggtcgacacggtcgccgacgtcgtcaaggccatcgagctcaggctc aagaacgaaggaaggctctcgggatga

DBGET integrated database retrieval system