Solanum tuberosum (potato): 102586920 Help Entry 102586920         CDS       T02981                                  Name (RefSeq) uncharacterized LOC102586920   KO K03873   elongin-B Organism sot  Solanum tuberosum (potato) Pathway sot04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102586920  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sot04121]     102586920    03400 DNA repair and recombination proteins [BR:sot03400]     102586920 Ubiquitin system [BR:sot04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      102586920    Cul5 complex      102586920 DNA repair and recombination proteins [BR:sot03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      102586920 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Dsc3_N UBL_UBAC1 Ubiquitin_2 DUF7909 DUF2340 Motif Other DBs NCBI-GeneID:  102586920 NCBI-ProteinID:  XP_006345800 UniProt:  M1C5L3 LinkDB All DBs Position Un AA seq 93 aa AA seqDB search MAMYIRVKRNKTTYFIQCDPTETILQMKEKLSNLIDQPANDQQLVLMPAGDVLEDSKSLA DQKVENDAVVALTLRKDDNEFEDVNIVKPDDEF NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcaatgtatatccgtgtgaagcgtaataagaccacctactttattcaatgtgaccca actgagacaattctacaaatgaaggagaaattgtctaacctcatagatcaacctgctaat gatcagcaattagtcctgatgcctgctggagatgtgttggaagactcgaagtccctagct gatcagaaggttgaaaatgacgctgtggtggcgctgactctgagaaaagatgacaatgaa ttcgaggatgtgaatatcgtgaaaccagatgatgaattttag

DBGET integrated database retrieval system