Solanum tuberosum (potato): 102588346 Help Entry 102588346         CDS       T02981                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism sot  Solanum tuberosum (potato) Pathway sot03083   Polycomb repressive complex sot04120   Ubiquitin mediated proteolysis sot04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102588346    04120 Ubiquitin mediated proteolysis     102588346   09126 Chromosome    03083 Polycomb repressive complex     102588346  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sot04131]     102588346    04121 Ubiquitin system [BR:sot04121]     102588346    03036 Chromosome and associated proteins [BR:sot03036]     102588346 Membrane trafficking [BR:sot04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     102588346 Ubiquitin system [BR:sot04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      102588346    Cul7 complex      102588346 Chromosome and associated proteins [BR:sot03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      102588346   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      102588346 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  102588346 NCBI-ProteinID:  XP_006347117 UniProt:  M1DS87 LinkDB All DBs Position Un AA seq 151 aa AA seqDB search MSSSTKLLTLKTCDGKEFVLDEAIAVRSQTIKNMVEDDCVSNVIPLPNVNSKTMTKVIEY WKKHSEEDVSKDMLMEFDKAFVKVHHSILHALILTANFLNDKEILDMMCEEVADRIKGKT PEEIRKEFDIKNDFTPEEEEEIRKENAWAFE NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttccacaaagctcttaactttaaagacttgtgatggtaaggaatttgtactc gatgaggcgatagctgtgaggtcacaaactatcaagaatatggttgaagacgattgtgtt tcaaacgtcattcccctgcctaatgtcaatagcaaaacaatgaccaaagtgattgaatac tggaagaaacattcggaggaagacgtctccaaagacatgttgatggagtttgacaaggct tttgtgaaggtgcaccactcgattttgcatgctcttatcttaactgctaattttcttaac gataaggagatattggatatgatgtgtgaagaagttgctgataggattaaagggaaaaca ccagaagaaatacgtaaagaatttgatatcaagaacgattttactccagaggaggaagag gagatccgtaaagagaatgcttgggcttttgaatga

DBGET integrated database retrieval system