Solanum tuberosum (potato): 102590461 Help Entry 102590461         CDS       T02981                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism sot  Solanum tuberosum (potato) Pathway sot03083   Polycomb repressive complex sot04120   Ubiquitin mediated proteolysis sot04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102590461    04120 Ubiquitin mediated proteolysis     102590461   09126 Chromosome    03083 Polycomb repressive complex     102590461  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sot04131]     102590461    04121 Ubiquitin system [BR:sot04121]     102590461    03036 Chromosome and associated proteins [BR:sot03036]     102590461 Membrane trafficking [BR:sot04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     102590461 Ubiquitin system [BR:sot04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      102590461    Cul7 complex      102590461 Chromosome and associated proteins [BR:sot03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      102590461   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      102590461 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  102590461 NCBI-ProteinID:  XP_006338557 UniProt:  M1DGS9 LinkDB All DBs Position Un AA seq 151 aa AA seqDB search MTSSTKFLTLKTCDGKEFVLDEAIAIRSQTIKNMVEDDCVSNVIPLPNVHSKTMTKVIEY WKKHSEEGVSKGMLMDFDKAFVNVHHSILHALILAANFLNDKEILDMMCQEIADRIKGKT PEEIRKEFDIKNDFTPEEEEEIRKENAWAFE NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgacttcttcaacaaagttcttaactctaaagacttgcgatggtaaggaatttgtactc gacgaggcaatagccataaggtcacaaactataaaaaatatggttgaagatgattgtgtt tcaaacgtcattcccctgcctaatgttcatagcaaaacaatgaccaaggtgatcgaatac tggaagaaacattcggaggaaggcgtctccaaaggcatgttgatggattttgacaaggct tttgtgaatgtgcaccactcgattttgcatgctcttatcttagctgctaattttcttaac gataaggagatattggatatgatgtgtcaagaaattgccgataggattaaagggaaaaca ccagaagaaatacgtaaagaatttgatatcaagaatgattttactccagaggaagaggag gagatccgtaaagagaatgcttgggcttttgaatga

DBGET integrated database retrieval system