Solanum tuberosum (potato): 102593160 Help Entry 102593160         CDS       T02981                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sot  Solanum tuberosum (potato) Pathway sot04145   Phagosome sot04148   Efferocytosis sot04620   Toll-like receptor signaling pathway sot05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sot00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102593160    04148 Efferocytosis     102593160  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102593160  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     102593160  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sot04131]     102593160   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sot04147]     102593160    04031 GTP-binding proteins [BR:sot04031]     102593160 Membrane trafficking [BR:sot04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     102593160  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     102593160   Macropinocytosis    Ras GTPases     102593160  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     102593160 Exosome [BR:sot04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102593160   Exosomal proteins of other body fluids (saliva and urine)    102593160   Exosomal proteins of colorectal cancer cells    102593160   Exosomal proteins of bladder cancer cells    102593160 GTP-binding proteins [BR:sot04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     102593160 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Sua5_C AAA_7 Motif Other DBs NCBI-GeneID:  102593160 NCBI-ProteinID:  XP_006354660 UniProt:  M0ZN52 LinkDB All DBs Position Un AA seq 208 aa AA seqDB search MNNSNSASNNATTTGTKFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVN VDGKIVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRPSFENISKKWVPELRHYA PSVPIVLVGTKLDLIEDKQFRRDYPGACTISTEQGEELKKQIGAVAYVECSAKTQQNVKA VFDTAIKVVLQPPKTKKQKRKHKACWIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgaataatagtaatagtgctagtaataatgctacaacaactggaacaaagttcatcaaa tgtgttactgttggagatggtgctgttgggaaaacttgccttctcatctcctacactagc aacactttccccactgattatgtgccaactgtgtttgacaatttcagtgctaatgttaat gttgatgggaagattgtgaatcttggcctgtgggatactgctggtcaagaggattataac aggcttaggcctcttagttatcgaggagccgatgtcttcctgcttgctttctctctcata agtaggcctagctttgaaaacatatcaaaaaagtgggttcctgagctaagacattatgcc ccatcagtgcctattgttctagtggggactaaattggatttaatagaggacaagcaattt agaagggactatcctggtgcatgtacaatttcaacagaacagggtgaagaactgaaaaaa caaataggcgcagtggcatacgttgagtgcagtgctaagacgcagcagaatgtgaaggct gtttttgatactgcaatcaaggtagttcttcagcctccaaagaccaaaaaacagaaaaga aaacacaaagcctgctggatactttga

DBGET integrated database retrieval system