Solanum tuberosum (potato): 102597429 Help Entry 102597429         CDS       T02981                                  Name (RefSeq) calmodulin-5/6/7/8-like   KO K02183   calmodulin Organism sot  Solanum tuberosum (potato) Pathway sot04016   MAPK signaling pathway - plant sot04070   Phosphatidylinositol signaling system sot04075   Plant hormone signal transduction sot04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:sot00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     102597429    04070 Phosphatidylinositol signaling system     102597429    04075 Plant hormone signal transduction     102597429  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     102597429  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sot01009]     102597429   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sot04131]     102597429    03036 Chromosome and associated proteins [BR:sot03036]     102597429   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sot04147]     102597429 Protein phosphatases and associated proteins [BR:sot01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102597429 Membrane trafficking [BR:sot04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102597429 Chromosome and associated proteins [BR:sot03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102597429 Exosome [BR:sot04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102597429 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 SPARC_Ca_bdg Allatotropin-like_C SAPC2_N EH Dockerin_1 EF_SSP120 EF-hand_EFHB_C RNA_pol_Rpb4 EF-hand_STIM1 PA_Ig-like SPEF2_C DUF5580_M RSA-1_C EF_EFCAB10_C Sigma54_CBD DUF7674 EF-hand_SWAP70_N SatS_C FAD-depend_C UPF0154 Motif Other DBs NCBI-GeneID:  102597429 NCBI-ProteinID:  XP_006351748 UniProt:  A0ABQ7WRL7 M1D715 LinkDB All DBs Position Un AA seq 147 aa AA seqDB search MADALTEDQISEFRQAFWVIDKDCDGVIRMEELASVIQSLHEHPTREEIQEMINEVDPDG DGSIDFEDFLNIMAKKLKDNVTEELKEAFKVFDRDQDGFISANELRNVMMNLGERLTEEE AQQMIREADLDGDGLVSYDEFVKIMII NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggctgatgcattaacagaagaccaaatttccgagtttcgtcaagccttttgggttatc gacaaggattgtgatggggtgataagaatggaggaacttgcgtcagtaattcaatcttta catgaacatccaacaagggaagaaatacaagaaatgataaatgaagtggatcctgatggt gatggttctattgattttgaagatttcttgaatatcatggctaaaaaactcaaggacaat gtaacggaggagctaaaagaagcattcaaagtatttgatcgcgatcaagatggatttatt tcggctaatgagttaagaaatgtgatgatgaatttgggggaaagattgacagaggaagaa gcccaacagatgattagagaggcagatcttgatggagatggcctcgtaagctatgacgaa tttgttaaaatcatgattatttag

DBGET integrated database retrieval system