Solanum tuberosum (potato): 102599250 Help Entry 102599250         CDS       T02981                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism sot  Solanum tuberosum (potato) Pathway sot03083   Polycomb repressive complex sot04120   Ubiquitin mediated proteolysis sot04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102599250    04120 Ubiquitin mediated proteolysis     102599250   09126 Chromosome    03083 Polycomb repressive complex     102599250  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sot04131]     102599250    04121 Ubiquitin system [BR:sot04121]     102599250    03036 Chromosome and associated proteins [BR:sot03036]     102599250 Membrane trafficking [BR:sot04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     102599250 Ubiquitin system [BR:sot04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      102599250    Cul7 complex      102599250 Chromosome and associated proteins [BR:sot03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      102599250   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      102599250 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  102599250 NCBI-ProteinID:  XP_006345342 LinkDB All DBs Position Un AA seq 153 aa AA seqDB search MSSEKLITLKTSDGEEFKPDESIVMRSQVIKNIVQDVDCASNVIPLTNVDGKTMCKVVEY WKKHSEEGVSKEVLMDFDKNFVKVDQSVLFYLLLTADFLNDKEMLDVMCQEVSNRIKGKT PEEIQIRKEFDIKNDFTLEEEEEIRKENAWAFE NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtcttcagaaaagctcataactctcaagactagcgatggcgaggaattcaaacccgat gagtctatagttatgaggtcgcaagtcatcaaaaacatagtacaagacgtggattgtgct tctaacgtcatccccctaactaatgttgatggaaaaactatgtgcaaagtggttgaatat tggaagaaacactcggaggaaggtgtatcgaaagaagtattgatggattttgacaagaat ttcgtgaaggtggatcagtcggttttgttttatcttctcttaactgctgattttcttaac gataaggagatgctggatgtaatgtgtcaagaagtttctaatagaatcaaaggtaaaacc ccagaggaaatacaaatacgtaaagaatttgatatcaagaatgattttactctagaggaa gaagaggagattcgtaaagagaatgcttgggcttttgaatga

DBGET integrated database retrieval system