Solanum tuberosum (potato): 102602946 Help Entry 102602946         CDS       T02981                                  Name (RefSeq) calmodulin-2/4-like   KO K02183   calmodulin Organism sot  Solanum tuberosum (potato) Pathway sot04016   MAPK signaling pathway - plant sot04070   Phosphatidylinositol signaling system sot04075   Plant hormone signal transduction sot04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:sot00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     102602946    04070 Phosphatidylinositol signaling system     102602946    04075 Plant hormone signal transduction     102602946  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     102602946  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sot01009]     102602946   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sot04131]     102602946    03036 Chromosome and associated proteins [BR:sot03036]     102602946   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sot04147]     102602946 Protein phosphatases and associated proteins [BR:sot01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102602946 Membrane trafficking [BR:sot04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102602946 Chromosome and associated proteins [BR:sot03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102602946 Exosome [BR:sot04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102602946 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_9 EF-hand_5 AIF-1 EF-hand_11 EF_EFCAB10_C EH UPF0154 EFhand_Ca_insen DUF5580_M PA_Ig-like Dockerin_1 SPARC_Ca_bdg SPEF2_C SurA_N_2 MotA_activ SurA_N_3 FCaBP_EF-hand DUF6279 Motif Other DBs NCBI-GeneID:  102602946 NCBI-ProteinID:  XP_006367979 UniProt:  M1BW30 LinkDB All DBs Position Un AA seq 113 aa AA seqDB search MRSLGQNPTEAELQDMINEVNADGNGTIDFPEFLNLMARKMKDIDSEEELKEAFRVFDKD QNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYDKFVKVMMAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgcgttcgttgggacaaaatccaactgaggctgagcttcaagatatgatcaatgaagtt aatgctgatggaaatggaaccattgacttccctgagttccttaacttgatggctcgcaag atgaaagacattgattctgaggaggagctcaaggaagctttcagagtgtttgacaaggat cagaatggattcatttctgcagctgagctacgccatgtcatgacaaacctaggcgagaag cttacagatgaagaggttgacgagatgattcgtgaagctgacgtggatggtgatggacag atcaactatgacaagttcgtcaaggtcatgatggccaagtga

DBGET integrated database retrieval system