Solanum tuberosum (potato): 107060217 Help Entry 107060217         CDS       T02981                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism sot  Solanum tuberosum (potato) Pathway sot03083   Polycomb repressive complex sot04120   Ubiquitin mediated proteolysis sot04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107060217    04120 Ubiquitin mediated proteolysis     107060217   09126 Chromosome    03083 Polycomb repressive complex     107060217  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sot04131]     107060217    04121 Ubiquitin system [BR:sot04121]     107060217    03036 Chromosome and associated proteins [BR:sot03036]     107060217 Membrane trafficking [BR:sot04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107060217 Ubiquitin system [BR:sot04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107060217    Cul7 complex      107060217 Chromosome and associated proteins [BR:sot03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107060217   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107060217 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 pRN1_helical Motif Other DBs NCBI-GeneID:  107060217 NCBI-ProteinID:  XP_015163298 LinkDB All DBs Position Un AA seq 146 aa AA seqDB search MAKVIKYWKKHSEYLDDKQLEEVIIQESFDRITGKTLEEIREVFGIVNDYTPEEEEQKHS EEDVSKDIVLEFDKAFVKVHHSILHALILAVNFLNYKEILDMMCQEVADRIKGKTPEEIH KEFDIKNDFTPEEEEEISKENGWDFE NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagtgattaaatattggaagaaacattcggaatatcttgatgataagcagctg gaggaagtaataatccaagaatcttttgataggatcacagggaaaacactagaggaaata cgtgaagtatttggtatcgtgaatgattatactccagaggaagaggagcagaaacattcg gaggaagatgtctccaaagacatagtgttggagtttgacaaggcttttgtgaaggtgcac cactcgattttgcatgcccttatcttagctgttaattttcttaactataaggagatattg gatatgatgtgtcaagaagttgccgataggattaaaggaaaaacaccagaagaaatacat aaagaatttgatatcaagaatgattttactcccgaggaagaagaggagatcagtaaagag aatggttgggattttgaatga

DBGET integrated database retrieval system