Solanum tuberosum (potato): 107060595
Help
Entry
107060595 CDS
T02981
Name
(RefSeq) SKP1-like protein 1B
KO
K03094
S-phase kinase-associated protein 1
Organism
sot
Solanum tuberosum (potato)
Pathway
sot03083
Polycomb repressive complex
sot04120
Ubiquitin mediated proteolysis
sot04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
sot00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
107060595
04120 Ubiquitin mediated proteolysis
107060595
09126 Chromosome
03083 Polycomb repressive complex
107060595
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
sot04131
]
107060595
04121 Ubiquitin system [BR:
sot04121
]
107060595
03036 Chromosome and associated proteins [BR:
sot03036
]
107060595
Membrane trafficking [BR:
sot04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
107060595
Ubiquitin system [BR:
sot04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
107060595
Cul7 complex
107060595
Chromosome and associated proteins [BR:
sot03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
107060595
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
107060595
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
DUF4284
Motif
Other DBs
NCBI-GeneID:
107060595
NCBI-ProteinID:
XP_015164120
LinkDB
All DBs
Position
Un
AA seq
151 aa
AA seq
DB search
MSLGKLITLKTNDNEEFKLDKTVAIKSEIIKNIVQDVDCTSNVIPLLNIDGKTMTKVVKY
WKKHSEEGVTEVQLKNFDQDFLKMSHSELHDVHLAAKYLDDNQLKEVIIQEFFDRIKGKP
IEEIREVFGIVNDYTPEEEEEVRRENAWAFE
NT seq
456 nt
NT seq
+upstream
nt +downstream
nt
atgtctttaggaaagctcataactcttaagactaacgataatgaggaattcaaactcgac
aagactgtagctataaagtcagaaatcatcaagaacatagtacaagacgttgattgtact
tctaatgtcatccccttgctcaatattgatggcaaaacaatgacaaaggtggttaaatat
tggaagaaacattcagaggaaggtgttacagaagtccagttaaagaattttgatcaggat
ttcttgaagatgagtcactcagaattacatgacgttcacttggctgctaaatatcttgat
gataaccaattaaaggaggtaataatccaagaattttttgataggatcaaagggaaacca
atagaggaaatacgtgaagtatttggtatcgtgaatgattataccccagaggaagaggag
gaggtccgtagagagaatgcttgggcttttgaatga
DBGET
integrated database retrieval system