Solanum tuberosum (potato): 107060603 Help Entry 107060603         CDS       T02981                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism sot  Solanum tuberosum (potato) Pathway sot03083   Polycomb repressive complex sot04120   Ubiquitin mediated proteolysis sot04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107060603    04120 Ubiquitin mediated proteolysis     107060603   09126 Chromosome    03083 Polycomb repressive complex     107060603  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sot04131]     107060603    04121 Ubiquitin system [BR:sot04121]     107060603    03036 Chromosome and associated proteins [BR:sot03036]     107060603 Membrane trafficking [BR:sot04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107060603 Ubiquitin system [BR:sot04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107060603    Cul7 complex      107060603 Chromosome and associated proteins [BR:sot03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107060603   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107060603 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 DndB Motif Other DBs NCBI-GeneID:  107060603 NCBI-ProteinID:  XP_015164133 UniProt:  M1DCG3 LinkDB All DBs Position Un AA seq 126 aa AA seqDB search MSSSTKFLTLKTYDGKEFVLDEVIVVRSQTIKTMVEDDCVSSVIPLPNVHSKTMTKVIEY WKKHSEEGVSKDMLMDFDKAFVKVHHSILHALILVVNFLNDKEILDMMCQEVADRIKGKT QEEIRK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttccacaaagttcttaactctaaagacttacgatggtaaagaatttgtactc gacgaggtgatagttgtaaggtcacaaactatcaagactatggttgaagatgattgtgtt tcaagcgtcattcccctacctaatgttcatagcaaaaccatgaccaaagtgatcgaatac tggaagaaacattcggaggaaggcgtctccaaagacatgctgatggattttgacaaggct tttgtgaaggtgcaccactcgattttgcatgctcttatcttagttgttaattttcttaac gataaggagatattggatatgatgtgtcaagaagttgccgataggattaaagggaaaaca caagaagaaatacgcaaataa

DBGET integrated database retrieval system