Solanum tuberosum (potato): 4099856 Help Entry 4099856           CDS       T02981                                  Symbol atpH, SotuCp008 Name (RefSeq) ATPase III subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism sot  Solanum tuberosum (potato) Pathway sot00190   Oxidative phosphorylation sot00195   Photosynthesis sot01100   Metabolic pathways Module sot_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sot00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4099856 (atpH)    00195 Photosynthesis     4099856 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sot00194]     4099856 (atpH) Photosynthesis proteins [BR:sot00194]  Photosystem and electron transport system   F-type ATPase [OT]    4099856 (atpH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  4099856 NCBI-ProteinID:  YP_635626 UniProt:  Q2VEI9 G1CC80 LinkDB All DBs Position CP AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttccgccgcttccgttattgctgctggattggccgtagggcttgct tctattggacctggaattggtcaagggactgctgcgggtcaagctgtagagggtatcgcg agacagcctgaggcagagggaaaaatacgaggtacgctattgcttagtctagcttttatg gaagctttaacaatttatggactggttgtagcattagcacttttatttgcaaatcctttt gtttaa

DBGET integrated database retrieval system