Stenotrophomonas oahuensis: PDM29_12100 Help Entry PDM29_12100       CDS       T10110                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sou  Stenotrophomonas oahuensis Pathway sou01100   Metabolic pathways sou01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sou00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PDM29_12100 (acpP)    00074 Mycolic acid biosynthesis     PDM29_12100 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PDM29_12100 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WNH51111 UniProt:  A0ABY9YJU1 LinkDB All DBs Position 2725044..2725283 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTNSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKISTVQAAIDYIKAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacagcttggcgtcaaggaa gaagaagtcaccaacagcgcatcgttcgtcgatgacctgggcgctgactcgctggacacc gttgagctggtgatggcgctggaagaagaattcgagtgcgagatcccggacgaagaagcc gaaaagatcagcaccgtgcaggctgccatcgactacatcaaggcccacgtcaaggcctga

DBGET integrated database retrieval system