Streptomyces olivoreticuli: QZH56_23795 Help Entry QZH56_23795       CDS       T09517                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sov  Streptomyces olivoreticuli Pathway sov00253   Tetracycline biosynthesis sov01056   Biosynthesis of type II polyketide backbone sov01100   Metabolic pathways sov01110   Biosynthesis of secondary metabolites Module sov_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sov00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     QZH56_23795    00253 Tetracycline biosynthesis     QZH56_23795  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sov01004]     QZH56_23795    01008 Polyketide biosynthesis proteins [BR:sov01008]     QZH56_23795 Lipid biosynthesis proteins [BR:sov01004]  Polyketide synthase   Component type    QZH56_23795 Polyketide biosynthesis proteins [BR:sov01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      QZH56_23795     Nonaketide PKS      QZH56_23795     Decaketide PKS      QZH56_23795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WKK21840 LinkDB All DBs Position 5373893..5374147 Genome browser AA seq 84 aa AA seqDB search MAQLTLDDLRRVLIACAGENDDVDLSGDILDVPFEELGYDSLALMESAAAIEREAGISVA DDAVSDAETPRALLDLINGAVRAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcacagctgacccttgacgacctccgccgcgtcctcatcgcctgcgcgggcgagaac gacgacgtcgacctgagcggcgacatcctcgacgtccccttcgaggagctcgggtacgac tcgctcgccctgatggagagcgccgccgccatagagcgcgaagcgggcatctccgtcgcc gacgacgcggtctccgacgccgagacgccgcgcgccctgctcgacctgatcaacggggcg gtccgggcggcctga

DBGET integrated database retrieval system