Sporosarcina oncorhynchi: QWT69_09295 Help Entry QWT69_09295       CDS       T10260                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sow  Sporosarcina oncorhynchi Pathway sow00998   Biosynthesis of various antibiotics sow01100   Metabolic pathways sow01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sow00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QWT69_09295    00074 Mycolic acid biosynthesis     QWT69_09295   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QWT69_09295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Guanylate_cyc DUF1493 Motif Other DBs NCBI-ProteinID:  WOV86147 UniProt:  A0ABZ0L1V2 LinkDB All DBs Position complement(1932326..1932568) Genome browser AA seq 80 aa AA seqDB search MNVLSVLERVTKVVVDRLGVDESEVKPEASFKDDLGADSLDVVELVMELEDEFDMEISDD DAEKIGTVGDAVKYIEEKVN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgaatgttttgtcagtacttgaacgcgtaacgaaagtagttgtcgaccgtcttggtgtc gatgaaagcgaagtaaaacctgaagcttctttcaaagacgatctcggcgcagactctttg gatgtcgttgagcttgtaatggaattagaagatgaattcgatatggaaatttccgatgac gacgccgaaaaaatcggaactgtcggtgatgctgttaaatatatcgaagaaaaagtaaat tag

DBGET integrated database retrieval system