Candidatus Nanosynbacter lyticus: TM7x_01440 Help Entry TM7x_01440        CDS       T03502                                  Name (GenBank) H(+)-transporting ATPase   KO K02110   F-type H+-transporting ATPase subunit c Organism sox  Candidatus Nanosynbacter lyticus Pathway sox00190   Oxidative phosphorylation sox01100   Metabolic pathways Module sox_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sox00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     TM7x_01440  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sox00194]     TM7x_01440 Photosynthesis proteins [BR:sox00194]  Photosystem and electron transport system   F-type ATPase [OT]    TM7x_01440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AJA06408 UniProt:  A0A6S4GQQ6 LinkDB All DBs Position 272536..272748 Genome browser AA seq 70 aa AA seqDB search MEALSFALTYAIPAAFAAIGAAIVGAAAMNAAGRNPEKINDLRTMMILGISFIDAIAIIG FVAAIVGKVM NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggaagcattatcatttgcacttacctacgcaatcccagctgcatttgcggcaatcggc gctgcaatcgttggcgcagctgctatgaacgccgctggtcgcaacccagaaaaaatcaac gacctacgcacaatgatgattttgggtatctctttcatcgacgcgattgctattattggt ttcgtcgcagcaatcgtcggcaaagttatgtag

DBGET integrated database retrieval system