Sitophilus oryzae (rice weevil): 115880221 Help Entry 115880221         CDS       T07985                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism soy  Sitophilus oryzae (rice weevil) Pathway soy03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:soy00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     115880221  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:soy03036]     115880221    03400 DNA repair and recombination proteins [BR:soy03400]     115880221 Chromosome and associated proteins [BR:soy03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      115880221 DNA repair and recombination proteins [BR:soy03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      115880221 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C TAF HMUD2 Histone TFIID-31kDa Motif Other DBs NCBI-GeneID:  115880221 NCBI-ProteinID:  XP_030753236 UniProt:  A0A6J2XQ93 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MTTEQKIRQTISNTAKKVTNEFGINSNIEYSADALNLIGEFVVNQLGMYANDLETFQRHA KRTQITVDDVKLLVRRNDSLKEFVDEKIKVISKNKPAEAPTTSKRKRKPTDSTS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgactacagaacaaaaaatccgtcaaacaatttcaaacactgcgaaaaaggtaactaac gaattcggaataaattctaatatcgaatatagtgctgatgcattgaatctaataggggaa tttgtagttaatcaactaggaatgtatgcgaatgatttggaaacatttcaaaggcacgcc aaaagaacacaaattacagtggatgatgtgaagttgttggtgagaagaaatgattcattg aaagaattcgtagatgaaaaaatcaaagttatttcgaaaaataaaccagctgaagctcca actacaagcaaaagaaaaagaaaacctaccgatagcacaagctag

DBGET integrated database retrieval system