Sitophilus oryzae (rice weevil): 115880623 Help Entry 115880623         CDS       T07985                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism soy  Sitophilus oryzae (rice weevil) Pathway soy03030   DNA replication soy03082   ATP-dependent chromatin remodeling soy03410   Base excision repair soy03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:soy00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     115880623    03410 Base excision repair     115880623    03420 Nucleotide excision repair     115880623   09126 Chromosome    03082 ATP-dependent chromatin remodeling     115880623  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:soy03032]     115880623    03036 Chromosome and associated proteins [BR:soy03036]     115880623    03400 DNA repair and recombination proteins [BR:soy03400]     115880623 Enzymes [BR:soy01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      115880623 DNA replication proteins [BR:soy03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     115880623 Chromosome and associated proteins [BR:soy03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     115880623 DNA repair and recombination proteins [BR:soy03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       115880623 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone Importin_rep_6 Motif Other DBs NCBI-GeneID:  115880623 NCBI-ProteinID:  XP_030753760 UniProt:  A0A6J2XSF4 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MAEKLEDLNLPGATVARIIKESLPDNVIIGKDARAALSRAASVFVLFLTSQASQEAQREK RKTLLGQDVIKALEELEFEDFIDPLQRVLKDFKESKGKKQPKSKKPNENGHEEVEEEQED DIVDEETGD NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggctgagaaattagaagacctaaatttacctggcgcaaccgtcgctagaattattaaa gaatctctaccggacaacgttattattggcaaagacgctagggcagctctctcaagagcc gcttcagtttttgtattatttcttacttcacaggcttcacaagaagcacaacgagaaaaa cggaaaaccttattaggtcaagatgtaataaaagctttggaggaattggaatttgaggat ttcatcgaccctttacaaagggtcctaaaagattttaaggaatcgaagggtaagaaacaa cctaaatcgaagaaacctaatgaaaatggccatgaagaagtcgaggaggaacaggaagat gatattgtggatgaagaaacaggagactga

DBGET integrated database retrieval system