Sitophilus oryzae (rice weevil): 115881514 Help Entry 115881514         CDS       T07985                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism soy  Sitophilus oryzae (rice weevil) Pathway soy04144   Endocytosis soy04517   IgSF CAM signaling soy04518   Integrin signaling soy05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:soy00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     115881514    04518 Integrin signaling     115881514  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115881514  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     115881514  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:soy04131]     115881514    03036 Chromosome and associated proteins [BR:soy03036]     115881514   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:soy04147]     115881514    04031 GTP-binding proteins [BR:soy04031]     115881514 Membrane trafficking [BR:soy04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     115881514  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     115881514   Macropinocytosis    Ras GTPases     115881514 Chromosome and associated proteins [BR:soy03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     115881514 Exosome [BR:soy04147]  Exosomal proteins   Exosomal proteins of microglial cells    115881514   Exosomal proteins of breast milk    115881514 GTP-binding proteins [BR:soy04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     115881514 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  115881514 NCBI-ProteinID:  XP_030754890 UniProt:  A0A6J2XV19 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQVDLR DDGATIEKLAKNKQKPISIEQGEKLARELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPVRRKKCLIL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacaattaaatgtgtggttgttggtgatggagcggtcggtaaaacatgtttactt attagctatacaaccaacaaatttccttcagaatatgttccaacagtatttgataactat gcagttactgttatgataggtggtgaaccatatacactaggactttttgatacagcaggt caggaagattatgataggcttaggcctttaagttacccacaaacagacgtcttcctagtt tgtttttcagtagtcagtccttcttcctttgaaaatgttaaagaaaagtgggttcctgaa ataacacaccactgtcaaaaaacgccatttctgcttgtcgggacacaagtggacctgaga gatgacggagctactatagaaaaactagccaaaaacaagcagaagccaatctccatcgag cagggtgaaaaattagctcgcgaacttaaagctgtcaaatacgtagagtgttccgctctg acacagaaaggtttgaagaacgtcttcgacgaggccatactagcggccctggaaccgcca gagccagtaagacgtaaaaaatgccttattctctaa

DBGET integrated database retrieval system