Sitophilus oryzae (rice weevil): 115882413 Help Entry 115882413         CDS       T07985                                  Name (RefSeq) putative gustatory receptor 2a   KO K08471   gustatory receptor Organism soy  Sitophilus oryzae (rice weevil) Brite KEGG Orthology (KO) [BR:soy00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04030 G protein-coupled receptors [BR:soy04030]     115882413 G protein-coupled receptors [BR:soy04030]  Others   Chemoreception    Insect odorant and taste     115882413 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  7tm_7 Motif Other DBs NCBI-GeneID:  115882413 NCBI-ProteinID:  XP_030756328 UniProt:  A0A6J2XXT5 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MCSLPLKSFIRKQISIFSRHLLHEEFSFTACGFFSINAALLQTIVGSVGVYLVMFIQFNS AGFQYSFSRRNASQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtgttcattgccactgaaatcctttatacgaaaacagataagcattttctcaagacat ttgcttcatgaagaattcagtttcacagcctgcggatttttttcgataaacgctgccctg ctgcaaacgattgtgggctctgtgggggtgtacctcgttatgtttattcagtttaattct gccggatttcagtattctttttctagacgcaacgcttcgcaataa

DBGET integrated database retrieval system